Premium DNA.
Fraction of the Cost.

Stop overpaying for gene synthesis. Get sequence-perfect, error-free dsDNA at prices that make large-scale projects finally feasible. From single genes to massive variant libraries.

100% Sequence Verified
No Hidden Fees
5-6 Business Day Delivery
$0.02
per base pair for gene fragments
$0.003
per base pair for high-volume pools
100%
sequence-verified accuracy

Why Scientists Choose Abstract Bio

We built the synthesis platform we always wanted. Transparent pricing, flawless DNA, no compromises.

Radically Lower Costs

Up to 90% less than traditional vendors. Scale your research without scaling your budget.

Sequence Perfect

Every gene fragment is NGS-verified before shipping. We stand behind the quality of our synthesis.

Cloning-Ready

Automatic codon optimization for your expression host. Ready for seamless assembly workflows.

Any Scale

From a single construct to 100,000+ variants. One platform, one workflow, massive flexibility.

See How Much You'll Save

Adjust the sliders to match your project and see instant pricing across all product types.

Individual, sequence-verified dsDNA fragments

Each fragment is synthesized and delivered in its own tube — perfect when you need precise control over individual constructs for cloning or assembly.

  • Gene synthesis, domain swaps, and pathway assembly
  • Codon optimization for any expression host
  • Compatible with Gibson, Golden Gate, and ligation-based workflows
  • Dry pellet or pre-resuspended delivery

Min Order

24 sequences

Length Range

300–1,000 bp

Price

$0.02 / bp

Estimate Your Cost

100
2410,000
500 bp
300 bp1,000 bp

Total Base Pairs

50,000 bp

Price per bp

$0.02

Estimated Total

$1.0K

Get Exact Quote

Traditional vendors charge $0.07–$0.10/bp — that would be $4.0K. You save 75%.

Three Products. Unlimited Possibilities.

Whether you need a single construct, ten thousand variants, or an ultra-accurate library, we have the right solution at the right price.

MOST POPULAR

Gene Fragments

Individual, error-free dsDNA fragments. Perfect for cloning, gene assembly, and precision work.

Length Range300 bp – 1 kb
Price$0.02/bp
Minimum Order24 sequences
Turnaround5-6 business days
Verification100% NGS sequenced
Delivery100ng–1ug, dried in 96-well plate
Order Gene Fragments
HIGH VOLUME

Pooled Fragments

Massive variant libraries in a single tube. Ideal for directed evolution, saturation mutagenesis, and screening.

Length Range300 bp – 650 bp
Price
From $0.003/bp
Volume-based tiers
Minimum Order200 sequences
Turnaround5-6 business days
Error Rate~1:500 bp
Delivery100ng–1ug, dried in tube
Order Pooled Fragments
ULTRA-ACCURATE

Low Skew & Error Pools

Ultra-accurate pooled DNA with 3–4× abundance skew. Fewer missed hits, better library coverage.

Length Range300 bp – 1 kb
Price
From $0.01/bp
Volume-based tiers
Minimum Order24 sequences
Turnaround5-6 business days
Error Rate1:20k–1:40k bp
Delivery100ng–1ug, dry or wet in tube
Order Low Skew & Error

Built-In Codon Optimization

Upload amino acid sequences and we'll automatically optimize codons for your expression host. Our algorithm maximizes expression while maintaining sequence integrity.

  • Five Expression Hosts

    E. coli, S. cerevisiae, Human, Mouse, CHO cells

  • Optimized Codon Usage

    Species-specific codon tables for maximum expression

  • Flexible Input Formats

    Upload FASTA, CSV, Excel—we handle the rest

# Input: Amino Acid Sequence
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFI
# Output: Optimized DNA (E. coli)
ATGGTGAGCAAAGGCGAAGAACTGTTTACCGGCGTGGTGCCGATTCTGGTGGAACTGGATGGCGATGTGAACGGCCACAAATTTAGCGTGAGCGGCGAAGGCGAAGGCGATGCGACCTATGGCAAACTGACCCTGAAATTTATT

Ready to Transform Your
DNA Synthesis Costs?

Join researchers who've discovered what's possible when synthesis costs don't limit ambition.

Start Your Order Now

No account required to get a quote. See real pricing in seconds.

Have questions? Contact us